SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000392457 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000392457
Domain Number 1 Region: 122-326
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.75e-69
Family PDEase 0.0000418
Further Details:      
 
Domain Number 2 Region: 37-117
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000000142
Family GAF domain 0.0000818
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000392457   Gene: ENSG00000186642   Transcript: ENST00000441209
Sequence length 327
Comment pep:putative chromosome:GRCh38:11:72579281:72584473:-1 gene:ENSG00000186642 transcript:ENST00000441209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPTASSVPEHKGVGFHAWDVRNLRKLRGQVPAGSLPPTDPSLHRWFLAPLPSPEVIGVAE
LVNKINGPWFSKFDEDLATAFSIYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSD
DEYTKLLHDGIQPVAAIDSNFASFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTL
ARFCLMVKKGYRDPPYHNWMHAFSVSHFCYLLYKNLELTNYLEDIEIFALFISCMCHDLD
HRGTNNSFQVASKSVLAALYSSEGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLD
LMRDIILATDLAHHLRIFKDLQKMAEG
Download sequence
Identical sequences H7C009
ENSP00000392457 ENSP00000392457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]