SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000392507 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000392507
Domain Number - Region: 11-47
Classification Level Classification E-value
Superfamily POZ domain 0.00133
Family BTB/POZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000392507   Gene: ENSG00000114648   Transcript: ENST00000442272
Sequence length 59
Comment pep:known chromosome:GRCh38:3:47282947:47344577:1 gene:ENSG00000114648 transcript:ENST00000442272 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MVEDGAEELEDLVHFSVSELPSRGYGVMEEIRRQGKLCDVTLKCPGGSDQLCLQRQPCH
Download sequence
Identical sequences A0A2I2ZSG1 A0A2I3T6W7 A0A2J8TFR8 F8WCL4
ENSP00000392507 ENSP00000392507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]