SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000392689 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000392689
Domain Number - Region: 16-36,64-78
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0431
Family Di-heme elbow motif 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000392689   Gene: ENSG00000223874   Transcript: ENST00000456163
Sequence length 97
Comment pep:putative chromosome:GRCh38:2:216870772:216871639:1 gene:ENSG00000223874 transcript:ENST00000456163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTRVEEQKKMVKACRYRCSACHLKYSPQRQKERKLSLKRNGRTSQQNMSMFWLKKLLES
GLFCAMCSPRASTKKGFWCRPKTTIIIIDYSSPRQCL
Download sequence
Identical sequences ENSP00000392689 9606.ENSP00000392689 ENSP00000392689 ENSP00000392689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]