SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000392926 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000392926
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily Rhomboid-like 0.00000000615
Family Rhomboid-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000392926   Gene: ENSG00000175193   Transcript: ENST00000418450
Sequence length 112
Comment pep:novel chromosome:GRCh38:3:183829390:183842354:-1 gene:ENSG00000175193 transcript:ENST00000418450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSIVNILGQEQFMAVYLSAGVISNFVSYVGKVATGRYGPSLGAALKAIIAMDTAGMILGW
KFFDHAAHLGGALFGIWYVTYGHELIWKNREPLVKIWHEIRTNGPKKGGGSK
Download sequence
Identical sequences H7C045
ENSP00000392926 ENSP00000392926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]