SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000393186 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000393186
Domain Number 1 Region: 17-58
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000331
Family RING finger domain, C3HC4 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000393186   Gene: ENSG00000229929   Transcript: ENST00000429069
Sequence length 59
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_SSTO_CTG1:30316876:30319415:1 gene:ENSG00000229929 transcript:ENST00000429069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETSLLEAGASAASTAAALENLQVEASCSVCLEYLKEPVIIECGHNFCKACITRWWED
Download sequence
Identical sequences A2AAZ3
ENSP00000391222 ENSP00000393186 ENSP00000397665 ENSP00000398453 ENSP00000404333 ENSP00000405498 ENSP00000413846 ENSP00000391222 ENSP00000393186 ENSP00000397665 ENSP00000398453 ENSP00000404333 ENSP00000405498 ENSP00000413846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]