SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000393235 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000393235
Domain Number 1 Region: 1-312
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.1e-89
Family Rhodopsin-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000393235   Gene: ENSG00000233180   Transcript: ENST00000444830
Sequence length 313
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_COX_CTG1:29082970:29083976:-1 gene:ENSG00000233180 transcript:ENST00000444830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNWENESSPKEFILLGFSDRAWLQMPLFVVLLISYTITIFGNVSIMMVCILDPKLHTPMY
FFLTNLSILDLCYTTTTVPHMLVNIGCNKKTISYAGCVAHLIIFLALGATECLLLAVMSF
DRYVAVCRPLHYVVIMNYWFCLRMAAFSWLIGFGNSVLQSSLTLNMPRCGHQEVDHFFCE
VPALLKLSCADTKPIEAELFFFSVLILLIPVTLILISYGFIAQAVLKIRSAEGRQKAFGT
CGSHMIVVSLFYGTAIYMYLQPPSSTSKDWGKMVSLFYGIITSMLNSLIYSLRNKDMKEA
FKRLMPRIFFCKK
Download sequence
Identical sequences A0A126GV76 O76000
9606.ENSP00000366378 9606.ENSP00000373149 9606.ENSP00000388604 9606.ENSP00000393235 9606.ENSP00000394571 9606.ENSP00000394593 9606.ENSP00000399881 9606.ENSP00000403571 ENSP00000366378 ENSP00000373149 ENSP00000388604 ENSP00000393235 ENSP00000394571 ENSP00000394593 ENSP00000399881 ENSP00000403571 NP_001005226.1.87134 NP_001005226.1.92137 ENSP00000366378 ENSP00000373149 ENSP00000388604 ENSP00000393235 ENSP00000394571 ENSP00000394593 ENSP00000399881 ENSP00000403571 gi|52421347|ref|NP_001005226.1| ENSP00000366378 ENSP00000373149 ENSP00000388604 ENSP00000393235 ENSP00000394571 ENSP00000394593 ENSP00000399881 ENSP00000403571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]