SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000393280 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000393280
Domain Number 1 Region: 9-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.76e-22
Family Ubiquitin-related 0.0000244
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000393280   Gene: ENSG00000096155   Transcript: ENST00000451534
Sequence length 244
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_QBL_CTG1:31637818:31642138:-1 gene:ENSG00000096155 transcript:ENST00000451534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLI
YQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGP
GASVHDRNANSYVMVGTFNLPSEPRVRLVMAQHMIRDIQTLLSRMECRGGPQPQHSQPPP
QPPAVTPEPVALSSQTSEPVESEAPPREPMEAEEVEERAPAQNPELTPGPAPAGPTPAPE
TNAP
Download sequence
Identical sequences F6WML8
ENSP00000391613 ENSP00000393280 ENSP00000393877 ENSP00000394240 ENSP00000394342 ENSP00000394714 ENSP00000394856 ENSP00000397639 ENSP00000400641 ENSP00000401031 ENSP00000403166 ENSP00000405607 ENSP00000406111 ENSP00000406319 ENSP00000406766 ENSP00000407212 ENSP00000407500 ENSP00000409846 ENSP00000410343 ENSP00000414697 ENSP00000414815 ENSP00000393280 ENSP00000394240 ENSP00000394714 ENSP00000394856 ENSP00000397639 ENSP00000400641 ENSP00000401031 ENSP00000403166 ENSP00000406111 ENSP00000406766 ENSP00000407212 ENSP00000409846 ENSP00000410343 ENSP00000414815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]