SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000393535 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000393535
Domain Number 1 Region: 23-202
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 6.23e-77
Family MHC antigen-recognition domain 0.0000000769
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000393535   Gene: ENSG00000235220   Transcript: ENST00000420067
Sequence length 254
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_DBB_CTG1:29720945:29724007:1 gene:ENSG00000235220 transcript:ENST00000420067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSD
AAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN
GCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTY
LEGECLELLRRYLENGKETLQRAEQSPQPTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKK
SSDRNRGSYSQAAV
Download sequence
Identical sequences NP_001091948.1.87134 NP_001091948.1.92137 gi|149158700|ref|NP_001091948.1| ENSP00000351977 ENSP00000366044 ENSP00000373007 ENSP00000393535 ENSP00000397376 ENSP00000399835 ENSP00000351977 ENSP00000366044 ENSP00000373007 ENSP00000393535 ENSP00000397376 ENSP00000399835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]