SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000393785 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000393785
Domain Number 1 Region: 3-184
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.85e-36
Family G proteins 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000393785   Gene: ENSG00000197885   Transcript: ENST00000443659
Sequence length 192
Comment pep:known chromosome:GRCh38:3:23892061:23916715:-1 gene:ENSG00000197885 transcript:ENST00000443659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDRGVKEQLHLY
DTRGLQEGVELPKHYFSFADGFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGN
KIDLSEQRQVDAEVAQQWAKSEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLP
GRKNKGNSNSEN
Download sequence
Identical sequences G2HF10 G3RC04 Q9NYS0
ENSPTRP00000025345 ENSGGOP00000013022 9598.ENSPTRP00000025345 9606.ENSP00000373411 ENSGGOP00000013022 gi|9966809|ref|NP_065078.1| NP_001233525.1.37143 NP_065078.1.87134 NP_065078.1.92137 XP_003826215.1.60992 XP_004033793.1.27298 XP_005265133.1.92137 XP_005265134.1.92137 XP_005265135.1.92137 XP_009443100.1.37143 XP_014685321.1.49734 XP_014685322.1.49734 XP_015345051.1.40921 XP_016795373.1.37143 XP_018878711.1.27298 ENSP00000373411 ENSP00000392307 ENSP00000393785 ENSP00000394214 ENSP00000400385 ENSP00000483749 ENSPTRP00000025345 ENSP00000373411 ENSP00000373411 ENSP00000392307 ENSP00000393785 ENSP00000394214 ENSP00000400385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]