SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000394069 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000394069
Domain Number 1 Region: 1-39
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.00000000418
Family Mitotic arrest deficient-like 1, Mad1 0.00023
Further Details:      
 
Weak hits

Sequence:  ENSP00000394069
Domain Number - Region: 49-90
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0235
Family Mitotic arrest deficient-like 1, Mad1 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000394069   Gene: ENSG00000002822   Transcript: ENST00000437877
Sequence length 122
Comment pep:putative chromosome:GRCh38:7:1898200:1940549:-1 gene:ENSG00000002822 transcript:ENST00000437877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLNPTSVARQRLREDHSQLQAECERLRGLLRAMERGGTVPADLEAAAASLPSSKEVAEL
KKQVESAELKNQRLKEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLI
FK
Download sequence
Identical sequences A0A2J8KJC4 C9JKI7
ENSP00000394069 ENSP00000394069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]