SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000395150 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000395150
Domain Number - Region: 6-77
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0368
Family Di-heme elbow motif 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000395150   Gene: ENSG00000009780   Transcript: ENST00000419687
Sequence length 227
Comment pep:known chromosome:GRCh38:1:27725996:27761473:1 gene:ENSG00000009780 transcript:ENST00000419687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQ
NVQLYGTVDGKLLCWLCTLSYKRVLQKTKEQRKHLSSSSRAGHQEKEQYSRLSGGGHYNS
FSPDLALDSPGTDHFVIIAQLKEEVATLKKMLHQKDQMILEKEKKITELKADFQYQESQM
RAKMNQMEKTHKEVTEQLQAKNRELLKQAAALSKSKKSEKSGAITSP
Download sequence
Identical sequences A0A2I3TUF2 A0A2J8Y5V6 A0A2K5ELY3 A0A2K5M538 A0A2K5RKT8 A0A2K5UD80 A0A2K6B5F0 A0A2K6KWG1 A0A2K6PSU3 A0A2K6THU3 F6V7G4 F7IHF7 G3QUY6
ENSP00000395150 NP_001137387.1.87134 NP_001137387.1.92137 XP_010344368.1.74449 XP_012295578.1.9421 XP_017390211.1.71028 ENSCJAP00000017127 gi|221139693|ref|NP_001137387.1| ENSP00000395150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]