SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000395354 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000395354
Domain Number 1 Region: 28-208
Classification Level Classification E-value
Superfamily PH domain-like 6.41e-25
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSP00000395354
Domain Number - Region: 260-309
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0199
Family Di-heme elbow motif 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000395354   Gene: ENSG00000178385   Transcript: ENST00000447645
Sequence length 469
Comment pep:known chromosome:GRCh38:2:207851238:207977450:-1 gene:ENSG00000178385 transcript:ENST00000447645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XNQNLYATYQLSHFQSISVLGNLEARMVDTVLYDNTQLQLKAESPWEALDWGQKLWEVVH
AAVPGYMGRQNELTISPGLGHHDDYTQNHSFQKKTSGLLPPSPVLDSSKQYQNILKSGTL
YRLTVQNNWKAFTFVLSRAYLMAFQPGKLDEDPLLSYNVDVCLAVQMDNLDGCDSCFQVI
FPQDVLRLRAETRQRAQEWMEALKIAANVARSSEQNLQVTLRNKPKDQMGGHELRKNKRQ
SVTTSFLSILTTLSLERGLTAQSFKCAGCQRSIGLSNGKAKVCNYSGWYYCSSCHVDDSF
LIPARIVHNWDTSKYKVSKQAKEFLEYVYEEPLIDIQQENAMLYHHAEPLAAVLRLRQRL
KSLRAYLFSCRAAVAEDLRRRIFPREYLLQQIHLYSLADLQQVIEGKLAPFLGKVIKFAT
SHVYSCSLCSQKGFICEICNNGEILYPFEDISTSRFGDPYADLLQGYVA
Download sequence
Identical sequences H7C0J9
ENSP00000395354 ENSP00000395354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]