SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000395603 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000395603
Domain Number 1 Region: 60-119
Classification Level Classification E-value
Superfamily PH domain-like 2.06e-18
Family Third domain of FERM 0.00094
Further Details:      
 
Domain Number 2 Region: 2-62
Classification Level Classification E-value
Superfamily Second domain of FERM 4.84e-17
Family Second domain of FERM 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000395603   Gene: ENSG00000088179   Transcript: ENST00000430976
Sequence length 135
Comment pep:known chromosome:GRCh38:2:119882503:119977461:1 gene:ENSG00000088179 transcript:ENST00000430976 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XELGDYDQSENLSGYLSDYSFIPNQPQDFEKEIAKLHQQHIGLSPAEAEFNYLNTARTLE
LYGVEFHYARDQSNNEIMIGVMSGGILIYKNRVRMNTFPWLKIVKISFKCKQFFIQLRKE
LVSTDLIIIDINEAF
Download sequence
Identical sequences J3QT59
ENSP00000395603 ENSP00000395603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]