SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000395845 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000395845
Domain Number 1 Region: 4-165
Classification Level Classification E-value
Superfamily ALDH-like 3.93e-34
Family ALDH-like 0.00000314
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000395845   Gene: ENSG00000072210   Transcript: ENST00000446398
Sequence length 166
Comment pep:known chromosome:GRCh38:17:19648136:19656392:1 gene:ENSG00000072210 transcript:ENST00000446398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELEVRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQE
VITVLGEIDFMLENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQ
PLIGAIAAGNAVIIKPSELSENTAKILAKLLPQYLDQDLYIVINGG
Download sequence
Identical sequences C9JGJ2
ENSP00000395845 ENSP00000395845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]