SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000396093 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000396093
Domain Number 1 Region: 23-200
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 9.31e-61
Family MHC antigen-recognition domain 0.00000000621
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000396093   Gene: ENSG00000160862   Transcript: ENST00000411734
Sequence length 227
Comment pep:putative chromosome:GRCh38:7:99966738:99976017:-1 gene:ENSG00000160862 transcript:ENST00000411734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQALGSLNDLQFFRYNS
KDRKSQPMGLWRQVEGMEDWKQDSQLQKAREDIFMETLKDIVEYYNDSNGSHVLQGRFGC
EIENNRSSGAFWKYYYDGKDYIEFNKEIPAWVPFDPAAQITKQKWEAEPVYVQRAKAYLE
EECPATLRKYLKYSKNILDRQGTHCFLLPSTEPRIKDDLRLGAQATS
Download sequence
Identical sequences C9JEV0
ENSP00000396093 ENSP00000396093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]