SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000396215 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000396215
Domain Number - Region: 1-37
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00119
Family GDI-like N domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000396215   Gene: ENSG00000203879   Transcript: ENST00000415109
Sequence length 46
Comment pep:known chromosome:GRCh38:X:154437166:154439052:1 gene:ENSG00000203879 transcript:ENST00000415109 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MDEEYDVIVLGTGLTMPLGVLVLEGHPVSAGCPASLKASVISLSAL
Download sequence
Identical sequences A0A2J8IN35 A0A2J8RLY1 F8WCU0
ENSP00000396215 ENSP00000396215 ENSP00000469501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]