SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000396311 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000396311
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 7.73e-35
Family Proteasome subunits 0.00000533
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000396311   Gene: ENSG00000242711   Transcript: ENST00000455846
Sequence length 131
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_APD_CTG1:32884108:32897709:1 gene:ENSG00000242711 transcript:ENST00000455846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHEHIYCALSGSAADAQAVADMAAYQL
ELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQP
FAIGGSGSTFI
Download sequence
Identical sequences A0A0G2JJQ0
ENSP00000396311 ENSP00000406077 ENSP00000409850 ENSP00000396311 ENSP00000406077 ENSP00000409850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]