SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000396466 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000396466
Domain Number 1 Region: 20-127
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000000000249
Family Pentapeptide repeats 0.017
Further Details:      
 
Domain Number 2 Region: 277-401
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000038
Family Canonical RBD 0.0032
Further Details:      
 
Domain Number 3 Region: 514-614
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000434
Family Canonical RBD 0.015
Further Details:      
 
Weak hits

Sequence:  ENSP00000396466
Domain Number - Region: 404-437
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.0392
Family Zn-finger domain of Sec23/24 0.0076
Further Details:      
 
Domain Number - Region: 816-858
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0452
Family Classic zinc finger, C2H2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000396466   Gene: ENSG00000004534   Transcript: ENST00000443081
Sequence length 991
Comment pep:putative chromosome:GRCh38:3:49940041:50077248:1 gene:ENSG00000004534 transcript:ENST00000443081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYRGGDGTSMDYRGREAPHMNYRDRDAHAVDFRGRDAPPSDFRGRGTYDLDFRGRDGSH
ADFRGRDLSDLDFRAREQSRSDFRNRDVSDLDFRDKDGTQVDFRGRGSGTTDLDFRDRDT
PHSDFRGRHRSRTDQDFRGREMGSCMEFKDREMPPVDPNILDYIQPSTQDREHSGMNVNR
REESTHDHTIERPAFGIQKGEFEHSETREGETQGVAFEHESPADFQNSQSPVQDQDKSQL
SGREEQSSDAGLFKEEGGLDFLGRQDTDYRSMEYRDVDHRLPGSQMFGYGQSKSFPEGKT
ARDAQRDLQDQDYRTGPSEEKPSRLIRLSGVPEDATKEEILNAFRTPDGMPVKNLQLKEY
NTGYDYGYVCVEFSLLEDAIGCMEANQGTLMIQDKEVTLEYVSSLDFWYCKRCKANIGGH
RSSCSFCKNPREVTEAKQELITYPQPQKTSIPAPLEKQPNQPLRPADKEPEPRKREEGQE
SRLGHQKREAERYLPPSRREGPTFRRDRERESWSGETRQDGESKTIMLKRIYRSTPPEVI
VEVLEPYVRLTTANVRIIKNRTGPMGHTYGFIDLDSHAEALRVVKILQNLDPPFSIDGKM
VAVNLATGKRRNDSGDHSDHMHYYQGKKYFRDRRGGGRNSDWSSDTNRQGQQSSSDCYIY
DSATGYYYDPLAGTYYDPNTQQEVYVPQDPGLPEEEEIKEKKPTSQGKSSSKKEMSKRDG
KEKKDRGVTRFQENASEGKAPAEDVFKKPLPPTVKKEESPPPPKVVNPLIGLLGEYGGDS
DYEEEEEEEQTPPPQPRTAQPQKREEQTKKENEEDKLTDWNKLACLLCRRQFPNKEVLIK
HQQLSDLHKQNLEIHRKIKQSEQELAYLERREREGKFKGRGNDRREKLQSFDSPERKRIK
YSRETDSDRKLVDKEDIDTSSKGGCVQQATGWRKGTGLGYGHPGLASSEEAEGRMRGPSV
GASGRTSKRQSNETYRDAVRRVMFARYKELD
Download sequence
Identical sequences E9PGM9
ENSP00000396466 XP_005264841.1.92137 XP_006712979.1.92137 ENSP00000396466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]