SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000396592 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000396592
Domain Number 1 Region: 44-186
Classification Level Classification E-value
Superfamily TPR-like 3.8e-25
Family Tetratricopeptide repeat (TPR) 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000396592   Gene: ENSG00000171853   Transcript: ENST00000415624
Sequence length 234
Comment pep:putative chromosome:GRCh38:2:3443868:3479571:1 gene:ENSG00000171853 transcript:ENST00000415624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVKTVCSKILANLEQGLAEDGGMSSVTQEGRQASIRLWRSRLGRVMYSMANCLLLMKDYV
LAVEAYHSVIKYYPEQEPQLLSGIGRISLQQIGDIKTAEKYFQDVEKVTQKLDGLQGKIM
VLMNSAFLHLGQNNFAEAHRFFTEILRMDPRNAVANNNAAVCLLYLGKLKDSLRQLEAMV
QQDPRHYLHESVLFNLTTMYELESSRSMQKKQALLEAVAGKEGDSFNTQCLKLA
Download sequence
Identical sequences H7C0T3
ENSP00000396592 ENSP00000396592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]