SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000396616 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000396616
Domain Number 1 Region: 145-453
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.99e-85
Family Transglutaminase core 0.000000738
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily E set domains 2.13e-42
Family Transglutaminase N-terminal domain 0.00015
Further Details:      
 
Domain Number 3 Region: 587-685
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 6.54e-28
Family Transglutaminase, two C-terminal domains 0.00083
Further Details:      
 
Domain Number 4 Region: 473-585
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 7.06e-28
Family Transglutaminase, two C-terminal domains 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000396616   Gene: ENSG00000166947   Transcript: ENST00000441366
Sequence length 691
Comment pep:known chromosome:GRCh38:15:43197230:43221051:-1 gene:ENSG00000166947 transcript:ENST00000441366 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQALGIKSCDFQAARNNEEHHTKALSSRRLFVRRGQPFTIILYFRAPVRAFLPALKKVA
LTAQTGEQPSKINRTQATFPISSLGDRKWWSAVVEERDAQSWTISVTTPADAVIGHYSLL
LQVSGRKQLLLGQFTLLFNPWNREDAVFLKNEAQRMEYLLNQNGLIYLGTADCIQAESWD
FGQFEGDVIDLSLRLLSKDKQVEKWSQPVHVARVLGALLHFLKEQRVLPTPQTQATQEGA
LLNKRRGSVPILRQWLTGRGRPVYDGQAWVLAAVACTVLRCLGIPARVVTTFASAQGTGG
RLLIDEYYNEEGLQNGEGQRGRIWIFQTSTECWMTRPALPQGYDGWQILHPSAPNGGGVL
GSCDLVPVRAVKEGTLGLTPAVSDLFAAINASCVVWKCCEDGTLELTDSNTKYVGNNIST
KGVGSDRCEDITQNYKYPEGSLQEKEVLERVEKEKMEREKDNGIRPPSLETASPLYLLLK
APSSLPLRGDAQISVTLVNHSEQEKAVQLAIGVQAVHYNGVLAAKLWRKKLHLTLSANLE
KIITIGLFFSNFERNPPENTFLRLTAMATHSESNLSCFAQEDIAICRPHLAIKMPEKAEQ
YQPLTASVSLQNSLDAPMEDCVISILGRGLIHRERSYRFRSVWPENTMCAKFQFTPTHVG
LQRLTVEVDCNMFQNLTNYKSVTVVAPELSA
Download sequence
Identical sequences P16452
ENSP00000396616 gi|166362737|ref|NP_001107606.1| ENSP00000396616 NP_001107606.1.87134 NP_001107606.1.92137 HR6312 NYSGRC-IgSF-EPB42_HUMAN

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]