SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000396691 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000396691
Domain Number 1 Region: 82-157
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0000157
Family Rhomboid-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000396691   Gene: ENSG00000175193   Transcript: ENST00000449306
Sequence length 159
Comment pep:novel chromosome:GRCh38:3:183833768:183884727:-1 gene:ENSG00000175193 transcript:ENST00000449306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRRFNFFIQQKCGFRKAPRKVEPRRSDPGTSGEAYKRSALIPPVEETVFYPSPYPIRSLI
KPLFFTVGINKWWNNLSDGQRTVTGIIAANVLVFCLWRVPSLQRTMIRYFTSNPASSVIS
NFVSYVGKVATGRYGPSLGASGAIMTVLAAVCTKIPEGR
Download sequence
Identical sequences H7C0U0
ENSP00000396691 ENSP00000396691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]