SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000396907 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000396907
Domain Number 1 Region: 23-207
Classification Level Classification E-value
Superfamily Cupredoxins 6.11e-56
Family Multidomain cupredoxins 0.00000664
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000396907   Gene: ENSG00000089472   Transcript: ENST00000458621
Sequence length 208
Comment pep:known chromosome:GRCh38:X:66164270:66173800:1 gene:ENSG00000089472 transcript:ENST00000458621 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESGHLLWALLFMQSLWPQLTDGATRVYYLGIRDVQWNYAPKGRNVITNQPLDSDIVASS
FLKSDKNRIGGTYKKTIYKEYKDDSYTDEVAQPAWLGFLGPVLQAEVGDVILIHLKNFAT
RPYTIHPHGVFYEKDSEGSLYPDGSSGPLKADDSVPPGGSHIYNWTIPEGHAPTDADPAC
LTWIYHSHVDAPRDIATGLIGPLITCKR
Download sequence
Identical sequences A0A2J8L3M3 A0A2J8UBB0 Q5JZ07
ENSP00000396907 ENSP00000396907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]