SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000397058 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000397058
Domain Number 1 Region: 56-256
Classification Level Classification E-value
Superfamily ADP-ribosylation 7.19e-49
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.035
Further Details:      
 
Weak hits

Sequence:  ENSP00000397058
Domain Number - Region: 7-30
Classification Level Classification E-value
Superfamily WWE domain 0.0334
Family WWE domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000397058   Gene: ENSG00000111224   Transcript: ENST00000427057
Sequence length 257
Comment pep:known chromosome:GRCh38:12:3808861:3873355:-1 gene:ENSG00000111224 transcript:ENST00000427057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWEVAHVSEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPPHWENVNTQVPYQLI
PLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQLKKKRGVPQINEQM
LFHGTSSEFVEAICIHNFDWRINGIHGAVFGKGTYFARDAAYSSRFCKDDIKHGNTFQIH
GVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNLYDSCVDDTWNPKIF
VVFDANQIYPEYLIDFH
Download sequence
Identical sequences A0A1D5QN65 A0A2I3LSH3 A0A2K5U101 A0A2K6AB49 A0A2K6E6W0 A0A2K6KDH7 A0A2K6PY81
NP_001273450.1.87134 NP_001273450.1.92137 NP_001273451.1.87134 NP_001273451.1.92137 XP_010357443.1.97406 XP_010357444.1.97406 XP_011743785.1.29376 XP_011743786.1.29376 XP_011822568.1.47321 XP_015285750.1.63531 XP_015285751.1.63531 XP_016875160.1.92137 XP_017720688.1.44346 XP_017720689.1.44346 ENSP00000397058 ENSP00000405385 ENSP00000397058 ENSP00000405385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]