SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000397944 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000397944
Domain Number 1 Region: 2-104
Classification Level Classification E-value
Superfamily Globin-like 1.03e-27
Family Globins 0.00000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000397944   Gene: ENSG00000198125   Transcript: ENST00000451685
Sequence length 106
Comment pep:known chromosome:GRCh38:22:35610884:35617586:-1 gene:ENSG00000198125 transcript:ENST00000451685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE
DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLE
Download sequence
Identical sequences A0A2J8QPD0 F2Z2F1
ENSP00000389263 ENSP00000397944 ENSP00000389263 ENSP00000397944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]