SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000398043 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000398043
Domain Number 1 Region: 16-149
Classification Level Classification E-value
Superfamily Rhomboid-like 1.1e-21
Family Rhomboid-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000398043   Gene: ENSG00000175193   Transcript: ENST00000417784
Sequence length 171
Comment pep:novel chromosome:GRCh38:3:183829390:183844274:-1 gene:ENSG00000175193 transcript:ENST00000417784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XQRTMIRYFTSNPASTNMYVLWSFSSSIVNILGQEQFMAVYLSAGVISNFVSYVGKVATG
RYGPSLGASGAIMTVLAAVCTKIPEGRLAIIFLPMFTFTAGNALKAIIAMDTAGMILGWK
FFDHAAHLGGALFGIWYVTYGHELIWKNREPLVKIWHEIRTNGPKKGGGSK
Download sequence
Identical sequences H7C122
ENSP00000398043 ENSP00000398043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]