SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000398107 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000398107
Domain Number 1 Region: 33-276
Classification Level Classification E-value
Superfamily Caspase-like 3.44e-95
Family Caspase catalytic domain 0.000000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000398107   Gene: ENSG00000165806   Transcript: ENST00000452490
Sequence length 278
Comment pep:known chromosome:GRCh38:10:113709345:113730907:1 gene:ENSG00000165806 transcript:ENST00000452490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRGLFSDGDTSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMG
VRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHG
EENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDT
DANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRV
NDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
Download sequence
Identical sequences ENSP00000398107 NP_001253987.1.87134 NP_001253987.1.92137 ENSP00000398107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]