SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000398517 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000398517
Domain Number 1 Region: 33-147
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 3.4e-31
Family Supernatant protein factor (SPF), C-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000398517   Gene: ENSG00000163820   Transcript: ENST00000438446
Sequence length 149
Comment pep:putative chromosome:GRCh38:3:45921585:45958661:-1 gene:ENSG00000163820 transcript:ENST00000438446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVGQDSEICLLKSGELMIKVPLTVDEIASFGEGSRELFVRSSTYSLIPITVAEAGLTIS
WVFSSDPKSISFSVVFQEAEDTPLDQCKVLIPTTRCNSHKENIQGQLKVRTPGIYMLIFD
NTFSRFVSKKVFYHLTVDRPVIYDGSDFL
Download sequence
Identical sequences C9J2W6
ENSP00000398517 ENSP00000398517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]