SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000398616 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000398616
Domain Number 1 Region: 27-145
Classification Level Classification E-value
Superfamily POZ domain 3.41e-35
Family BTB/POZ domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000398616   Gene: ENSG00000099910   Transcript: ENST00000458248
Sequence length 235
Comment pep:known chromosome:GRCh38:22:20465265:20495795:-1 gene:ENSG00000099910 transcript:ENST00000458248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEQEFTQLCKLPAQPSHPHCVNNTYRSAQHSQALLRGLLALRDSGILFDVVLVVEGRH
IEAHRILLAASCDYFRGMFAGGLKEMEQEEVLIHGVSYNAMCQILHFIYTSELELSLSNV
QETLVAACQLQIPEIIHFCCDFLMSWVDEENILDVYRLAELFDLSRLTEQLDTYILKNFV
AFSRTDKYRQLPLEKVYSLLSSNRLEVSCETEVYEGALLYHYSLEQVQADQISLH
Download sequence
Identical sequences C9J2T1
ENSP00000398616 ENSP00000398616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]