SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000398878 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000398878
Domain Number 1 Region: 135-354,381-482
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.22e-65
Family Pancreatic carboxypeptidases 0.00000575
Further Details:      
 
Domain Number 2 Region: 482-574
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 3.73e-21
Family Carboxypeptidase regulatory domain 0.00029
Further Details:      
 
Domain Number 3 Region: 34-84
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000086
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000398878   Gene: ENSG00000106624   Transcript: ENST00000450684
Sequence length 733
Comment pep:putative chromosome:GRCh38:7:44110731:44114562:1 gene:ENSG00000106624 transcript:ENST00000450684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKWWAPCPGSWLCSHCLGEGWALRGAGSTALRPASPQTFHGNVDKDTPVLSELPEPVVA
RFIRIYPLTWNGSLCMRLEVLGCSVARECGGLAGALSGGGVLGWASRHPAKDNPASLAAV
YSYYAQNEVVATDDLDFRHHSYKDMRQLMKVVNEECPTITRTYSLGKSSRGLKIYAMEIS
DNPGEHELGEPEFRYTAGIHGNEVLGRELLLLLMQYLCREYRDGNPRVRSLVQDTRIHLV
PSLNPDGYEVAAQMGSEFGNWALGLWTEEGFDIFEDFPDLNSVLWGAEERKWVPYRVPNN
NLPIPERYLSPDATVSTEVRAIIAWMEKNPFVLGANLNGGERLVSYPYDMARTPTQEQLL
AAAMAAARGEDEDEVSEAQETPDHAIFRWLAISFASAHLTLTEPYRGGCQAQDYTGGMGI
VNGAKWNPRTGTINDFSYLHTNCLELSFYLGCDKFPHESELPREWENNKEALLTFMEQVH
RGIKGVVTDEQGIPIANATISVSGINHGVKTASGGDYWRILNPGEYRVTAHAEGYTPSAK
TCNVDYDIGATQCNFILARSNWKRIREIMAMNGNRPIPHIDPSRPMTPQQRRLQQRRLQH
RLRLRAQMRLRRLNATTTLGPHTVPPTLPPAPATTLSTTIEPWGLIPPTTAGWEESETET
YTEVVTEFGTEVEPEFGTKVEPEFETQLEPEFETQLEPEFEEEEEEEKEEEIATGQAFPF
TTVETYTVNFGDF
Download sequence
Identical sequences ENSP00000398878 ENSP00000398878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]