SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000399160 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000399160
Domain Number 1 Region: 1-121
Classification Level Classification E-value
Superfamily alpha-ketoacid dehydrogenase kinase, N-terminal domain 1.01e-44
Family alpha-ketoacid dehydrogenase kinase, N-terminal domain 0.00000181
Further Details:      
 
Domain Number 2 Region: 132-228
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000000000000281
Family alpha-ketoacid dehydrogenase kinase, C-terminal domain 0.0000407
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000399160   Gene: ENSG00000152256   Transcript: ENST00000416991
Sequence length 229
Comment pep:putative chromosome:GRCh38:2:172556313:172570812:1 gene:ENSG00000152256 transcript:ENST00000416991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSCFTDTV
IRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLF
GGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQ
PIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNED
Download sequence
Identical sequences C9IYB4
ENSP00000399160 ENSP00000399160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]