SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000399463 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000399463
Domain Number 1 Region: 2-153
Classification Level Classification E-value
Superfamily SIS domain 0.0000000186
Family mono-SIS domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000399463   Gene: ENSG00000084734   Transcript: ENST00000453813
Sequence length 227
Comment pep:putative chromosome:GRCh38:2:27497268:27501830:1 gene:ENSG00000084734 transcript:ENST00000453813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PITEKSNPLTQDLDKADAENIVRLLGQCDAEIFQEEGQALSTYQRLYSESILTTMVQVAG
KVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVSFNQLMKGLGQKPLYTYLIAGGDRSVVAS
REGTEDSALHGIEELKKVAAGKKRVIVIGISVGLSAPFVAGQMDCCMNNTAVFLPVLVGF
NPVSMARHPFPPPRILRSLTVFPSLRAPHYQITSLLFSMSVVTLISE
Download sequence
Identical sequences H7C1B4
ENSP00000399463 ENSP00000399463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]