SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000399505 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000399505
Domain Number 1 Region: 16-59
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000824
Family Caspase recruitment domain, CARD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000399505   Gene: ENSG00000106100   Transcript: ENST00000413433
Sequence length 60
Comment pep:known chromosome:GRCh38:7:30456743:30478636:-1 gene:ENSG00000106100 transcript:ENST00000413433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEQGHSEMEIIPSESHPHIQLLKSNRELLVTHIRNTQCLVDNLLKNDYFSAEDAEIVCA
Download sequence
Identical sequences A0A2J8KLC4 Q7Z2K1
ENSP00000395551 ENSP00000396046 ENSP00000399505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]