SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000399596 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000399596
Domain Number 1 Region: 44-100
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.7e-17
Family CRAL/TRIO N-terminal domain 0.0000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000399596   Gene: ENSG00000100003   Transcript: ENST00000415072
Sequence length 125
Comment pep:putative chromosome:GRCh38:22:30398577:30407477:1 gene:ENSG00000100003 transcript:ENST00000415072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCFIGSRVRPPLSSLCSPANSSSFHGAEDHGGKSVCSGLRQTRFRENVQDVLPALPNPD
DYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLD
GCPVW
Download sequence
Identical sequences C9JTM4
ENSP00000399596 ENSP00000399596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]