SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000399694 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000399694
Domain Number 1 Region: 25-150
Classification Level Classification E-value
Superfamily Rhomboid-like 7.59e-24
Family Rhomboid-like 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000399694   Gene: ENSG00000144468   Transcript: ENST00000423616
Sequence length 151
Comment pep:known chromosome:GRCh38:2:226836050:226867206:1 gene:ENSG00000144468 transcript:ENST00000423616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRRSRGINTGLILLLSQIFHVGINNIPPVTLATLALNIWFFLNPQKPLYSSCLSVEKCY
QQKDWQRLLLSPLHHADDWHLYFNMASMLWKGINLERRLGSRWFAYVITAFSVLTGVVYL
LLQFAVAEFMDEPDFKRSCAVGFSGVLFALK
Download sequence
Identical sequences C9K011
ENSP00000399694 ENSP00000399694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]