SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000399973 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000399973
Domain Number 1 Region: 6-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000249
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000399973   Gene: ENSG00000154040   Transcript: ENST00000415309
Sequence length 221
Comment pep:known chromosome:GRCh38:18:24139062:24161603:1 gene:ENSG00000154040 transcript:ENST00000415309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVK
QFHQIKVEKWSEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTT
QFPSVYAVPGTEQTEAVGGLSSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQML
EDVAKKSSGSGDKCAPFGSYGIAGEVTVTTAHKRRKAETEN
Download sequence
Identical sequences NP_722454.1.87134 NP_722454.1.92137 ENSP00000399973 gi|24797118|ref|NP_722454.1| ENSP00000399973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]