SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000400285 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000400285
Domain Number 1 Region: 23-250
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 1.96e-72
Family Aldo-keto reductases (NADP) 0.000000000701
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000400285   Gene: ENSG00000069424   Transcript: ENST00000428161
Sequence length 254
Comment pep:known chromosome:GRCh38:1:6026300:6095625:1 gene:ENSG00000069424 transcript:ENST00000428161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYPESTTGSPARLSLRQTGSPGMIYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEQLMT
LAYDNGINLFDTAEVYAAGKAEVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRK
HIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSME
IMEAYSVARQFNLTPPICEQAEYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGK
YDSGIPPYSRASLK
Download sequence
Identical sequences A0A2J8KYA2 Q5TG80
ENSP00000400285 ENSP00000400285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]