SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000400449 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000400449
Domain Number 1 Region: 5-192
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.12e-57
Family D-ribulose-5-phosphate 3-epimerase 0.00000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000400449   Gene: ENSG00000197713   Transcript: ENST00000452025
Sequence length 225
Comment pep:putative chromosome:GRCh38:2:210002643:210019766:1 gene:ENSG00000197713 transcript:ENST00000452025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQ
LGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
PGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGP
DTVHKCAEIGVQWRDLCSLQSLPAGFKRFSCLSLLSSWDYRQELT
Download sequence
Identical sequences C9IZU8
ENSP00000400449 NP_001305856.1.87134 NP_001305856.1.92137 ENSP00000400449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]