SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000400533 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000400533
Domain Number 1 Region: 26-113
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 2.36e-25
Family Interleukin 8-like chemokines 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000400533   Gene: ENSG00000106178   Transcript: ENST00000416943
Sequence length 119
Comment pep:known chromosome:GRCh38:7:75811665:75823356:-1 gene:ENSG00000106178 transcript:ENST00000416943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLMTIVTSLLFLGVCAHHIIPTGSVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLK
AGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC
Download sequence
Identical sequences O00175
ENSP00000222902 ENSP00000400533 ENSP00000461415 ENSP00000461512 NP_002982.2.87134 NP_002982.2.92137 XP_011514761.1.92137 XP_011514762.1.92137 ENSP00000222902 ENSP00000400533 ENSP00000222902 ENSP00000461415 9606.ENSP00000222902 gi|22165427|ref|NP_002982.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]