SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000400735 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000400735
Domain Number 1 Region: 1-139
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.49e-29
Family AlaX-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000400735   Gene: ENSG00000266967   Transcript: ENST00000430739
Sequence length 140
Comment pep:putative chromosome:GRCh38:17:42955901:42964498:-1 gene:ENSG00000266967 transcript:ENST00000430739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQHSGQHLITAVADHLFKLKTTSWELGRFRSAIELDTPSMTAEQVAAIEQSVNEKIRDR
LPVNVRELSLDDPEVEQVSGRGLPDDHAGPIRVVNIEGVDSNMCCGTHVSNLSDLQVIKI
LGTEKGKKNRTNLIFLSGNR
Download sequence
Identical sequences L7N2F4
ENSP00000400735 ENSP00000400735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]