SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000400765 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000400765
Domain Number 1 Region: 25-123
Classification Level Classification E-value
Superfamily Rhomboid-like 1.83e-19
Family Rhomboid-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000400765   Gene: ENSG00000144468   Transcript: ENST00000424132
Sequence length 134
Comment pep:known chromosome:GRCh38:2:226835581:226865097:1 gene:ENSG00000144468 transcript:ENST00000424132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRRSRGINTGLILLLSQIFHVGINNIPPVTLATLALNIWFFLNPQKPLYSSCLSVEKCY
QQKDWQRLLLSPLHHADDWHLYFNMASMLWKGINLERRLGSRWFAYVITAFSVLTGVVYL
LLQFAVAEFMDEPD
Download sequence
Identical sequences C9J1R4
ENSP00000400765 ENSP00000400765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]