SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000401158 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000401158
Domain Number 1 Region: 20-82
Classification Level Classification E-value
Superfamily Homeodomain-like 2.27e-22
Family Homeodomain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000401158   Gene: ENSG00000130675   Transcript: ENST00000428439
Sequence length 82
Comment pep:known chromosome:GRCh38:7:157005842:157009435:-1 gene:ENSG00000130675 transcript:ENST00000428439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGLSTVGACPGILGAQQAQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRF
EVATSLMLTETQVKIWFQNRRM
Download sequence
Identical sequences C9K088
ENSP00000401158 ENSP00000401158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]