SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000401224 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000401224
Domain Number 1 Region: 27-117
Classification Level Classification E-value
Superfamily Immunoglobulin 5.59e-20
Family I set domains 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000401224   Gene: ENSG00000104970   Transcript: ENST00000434659
Sequence length 133
Comment pep:known chromosome:GRCh38:19:54532692:54543815:1 gene:ENSG00000104970 transcript:ENST00000434659 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAPKLITVLCLGFCLNQKICPHAGAQDKFSLSAWPSPVVPLGGRVTLSCHSHLRFVIWTI
FQTTGTRSHELHTGLSNNITISPVTPEHAGTYRCVGIYKHASKWSAESNSLKIIVTGGPH
DEAGREVDPLLQL
Download sequence
Identical sequences F2Z2P8
ENSP00000396692 ENSP00000401224 ENSP00000396692 ENSP00000401224 ENSP00000481832 ENSP00000483894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]