SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000401314 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000401314
Domain Number 1 Region: 9-83
Classification Level Classification E-value
Superfamily Ras GEF 0.0000000000575
Family Ras GEF 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000401314   Gene: ENSG00000068831   Transcript: ENST00000430645
Sequence length 84
Comment pep:novel chromosome:GRCh38:11:64741068:64744867:-1 gene:ENSG00000068831 transcript:ENST00000430645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIY
QQSRKDNSNSLQVKTCHLVRYWIS
Download sequence
Identical sequences A0A2J8QCM4 A0A2J8TYU2
ENSP00000401314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]