SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000401321 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000401321
Domain Number 1 Region: 624-866
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.98e-54
Family Ankyrin repeat 0.000000927
Further Details:      
 
Domain Number 2 Region: 13-55
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000105
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 1-136
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000251
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 4 Region: 298-329
Classification Level Classification E-value
Superfamily Notch domain 0.0000000915
Family Notch domain 0.0025
Further Details:      
 
Domain Number 5 Region: 261-291
Classification Level Classification E-value
Superfamily Notch domain 0.00000536
Family Notch domain 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSP00000401321
Domain Number - Region: 220-249
Classification Level Classification E-value
Superfamily Notch domain 0.00144
Family Notch domain 0.0034
Further Details:      
 
Domain Number - Region: 134-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00179
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 179-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0028
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000401321   Gene: ENSG00000238196   Transcript: ENST00000425600
Sequence length 1048
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_APD_CTG1:32261849:32271406:-1 gene:ENSG00000238196 transcript:ENST00000425600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAPGYDGQNCSKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPC
HPTGTAACHSLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICHC
PKGFEGPTCSHRAPSCGFHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCG
PPSPCLYNGSCSETTGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAGCSGPG
GNWDGGDCSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAY
DQYCHDHFHNGHCEKGCNTAECGWDGGDCRPEDGDPEWGPSLALLVVLSPPALDQQLFAL
ARVLSLTLRVGLWVRKDRDGRDMVYPYPGARAEEKLGGTRDPTYQERAAPQTQPLGKETD
SLSAGFVVVMGVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAVHPH
AGTAPPANQLPWPVLCSPVAGVILLALGALLVLQLIRRRRREHGALWLPPGFTRRPRTQS
APHRRRPPLGEDSIGLKALKPKAEVDEDGVVMCSGPEEGEEVGQAEETGPPSTCQLWSLS
GGCGALPQAAMLTPPQESEMEAPDLDTRGPDGVTPLMSAVCCGEVQSGTFQGAWLGCPEP
WEPLLDGGACPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAV
AADAREVCQLLLRSRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAAQADVGARDKWGK
TALHWAAAVNNARAARSLLQAGADKDAQDNREQTPLFLAAREGAVEVAQLLLGLGAAREL
RDQAGLAPADVAHQRNHWDLLTLLEGAGPPEARHKATPGREAGPFPRARTVSVSVPPHGG
GALPRCRTLSAGAGPRGGGACLQARTWSVDLAARGGGAYSHCRSLSGVGAGGGPTPRGRR
FSAGMRGPRPNPAIMRGRYGVAAGRGGRVSTDDWPCDWVALGACGSASNIPIPPPCLTPS
PERGSPQLDCGPPALQEMPINQGGEGKK
Download sequence
Identical sequences 9606.ENSP00000401321 ENSP00000448391 ENSP00000401321 ENSP00000401321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]