SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000401340 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000401340
Domain Number 1 Region: 1-45
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.00000000000107
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000401340   Gene: ENSG00000188010   Transcript: ENST00000441049
Sequence length 68
Comment pep:known chromosome:GRCh38:2:38875991:38929072:1 gene:ENSG00000188010 transcript:ENST00000441049 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MNGFGRLEHFSGAVYEGQFKDNMFHGLGTYTFPNGAKYTGNFNENRGSQASLLLLFITFK
LIQNPDKP
Download sequence
Identical sequences F8WEM8
ENSP00000401340 ENSP00000401340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]