SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000401879 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000401879
Domain Number 1 Region: 19-121
Classification Level Classification E-value
Superfamily Nudix 2.8e-24
Family IPP isomerase-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000401879   Gene: ENSG00000067064   Transcript: ENST00000429642
Sequence length 122
Comment pep:novel chromosome:GRCh38:10:1042632:1048883:-1 gene:ENSG00000067064 transcript:ENST00000429642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEINTNHLDKQQVQLLAEMCILIDENDNKIGAETKKNCHLNENIEKGLLHRAFSVFLFN
TENKLLLQQRSDAKITFPGCFTNTCCSHPLSNPAELEESDALGVRRAAQRRLKAELGIPL
EE
Download sequence
Identical sequences C9JKM8
ENSP00000401879 ENSP00000401879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]