SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000402119 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000402119
Domain Number - Region: 79-112
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0418
Family Integrin alpha N-terminal domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000402119   Gene: ENSG00000167930   Transcript: ENST00000438220
Sequence length 131
Comment pep:novel chromosome:GRCh38:16:234829:260003:1 gene:ENSG00000167930 transcript:ENST00000438220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDHKDLEAEIHPLKNEERKSQENLGNPSKNEDNVKSAPPQSRLSRCRAAAFFLSLFLCL
FVVFVVSFVIPCPDRPASQRMWRIDYSAAVIYDFLAVDDINGDRIQDVLFLYKNTNSSNN
FSRSCVDEAAV
Download sequence
Identical sequences C9JP72
ENSP00000402119 ENSP00000402119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]