SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000402137 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000402137
Domain Number 1 Region: 168-273
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0000458
Family Rhomboid-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000402137   Gene: ENSG00000175193   Transcript: ENST00000435888
Sequence length 295
Comment pep:novel chromosome:GRCh38:3:183829397:183884855:-1 gene:ENSG00000175193 transcript:ENST00000435888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWRGWAQRGWGCGQAWGASVGGRSCEELTAVLTPPQLLGRRFNFFIQQKCGFRKAPRKV
EPRRSDPGTSGEAYKRSALIPPVEETVFYPSPYPIRSLIKPLFFTVGFTGCAFGSAAIWQ
YESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEINKWWNNLSDGQRTVTGIIAANVLVF
CLWRVPSLQRTMIRYFTSNPASSVISNFVSYVGKVATGRYGPSLGAALKAIIAMDTAGMI
LGWKFFDHAAHLGGALFGIWYVTYGHELIWKNREPLVKIWHEIRTNGPKKGGGSK
Download sequence
Identical sequences C9JNP8
NP_001311366.1.87134 NP_001311366.1.92137 ENSP00000402137 ENSP00000402137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]