SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000402249 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000402249
Domain Number 1 Region: 19-126
Classification Level Classification E-value
Superfamily Rhomboid-like 0.000000000275
Family Rhomboid-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000402249   Gene: ENSG00000134882   Transcript: ENST00000457666
Sequence length 135
Comment pep:putative chromosome:GRCh38:13:99200916:99244624:1 gene:ENSG00000134882 transcript:ENST00000457666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTKPRRPPRPHLVSPDKAPLSKSLLLVPSALSLLLALLLPHCQKLFVYDLHAVKNDFQI
WRLICGRIICLDLKDTFCSSLLIYNFRIFERRYGSRKFASFLLGSWVLSALFDFLLIEAM
QYFFGITAASNLPSG
Download sequence
Identical sequences A0A2J8M9A0 A0A2J8X8G8 Q5JUH4
ENSP00000402249 ENSP00000402249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]