SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000402631 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000402631
Domain Number 1 Region: 173-248
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000638
Family G proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000402631   Gene: ENSG00000228581   Transcript: ENST00000443235
Sequence length 264
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_MCF_CTG1:30631813:30634541:-1 gene:ENSG00000228581 transcript:ENST00000443235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGERVLWPLRAGQHWRHRPLPAGLQDGLRSSSNSRSGSRERREEQTDTSDGESVTHHIRR
LNQQPSQGLGPRGYDPNRYRLHFERDSREEVERRKRAAREQVLQPVSAELLELDIREVYQ
PGSVLDFPRRPPWSYEMSKEQLMSQEERSFQDYLGKIHGAYSSEKLSYFEHNLETWRQLW
RVLEMSDIVLLITDIRHPVVNFPPALYEYVTGELGLALVLVLNKVDLAPPALVVAWKHYF
HQHYPQLHVVLFTSFPRDPRTPQD
Download sequence
Identical sequences A2AB27
ENSP00000392654 ENSP00000400869 ENSP00000400970 ENSP00000402631 ENSP00000404728 ENSP00000407819 ENSP00000409984 ENSP00000392654 ENSP00000400869 ENSP00000400970 ENSP00000402631 ENSP00000404728 ENSP00000407819 ENSP00000409984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]